Loading...
Statistics
Thomasma.com
Thomasma.com is hosted in
United States
/
Houston
.
Thomasma.com uses HTTPS protocol.
Number of used technologies:
1.
First technologies:
Html,
Number of used javascripts: 0.
Number of used analytics tools:
0.
Its server type is:
nginx/1.10.1.
Technologies in use by Thomasma.com
Technology
Number of occurences: 1
- Html
Advertisement
Server Type
- nginx/1.10.1
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Not founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Thomasma.com
SSL certificate
- name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.websitewelcome.com
- subject:
- OU:
- 0: Domain Control Validated
- 1: Hosted by HostGator.com, LLC.
- 2: PositiveSSL Wildcard
- CN: *.websitewelcome.com
- OU:
- hash: b86b2c33
- issuer:
- C: GB
- ST: Greater Manchester
- L: Salford
- O: COMODO CA Limited
- CN: COMODO RSA Domain Validation Secure Server CA
- version: 2
- serialNumber: 73802823338622261546480845931487065049
- validFrom: 151016000000Z
- validTo: 181015235959Z
- validFrom_time_t: 1444953600
- validTo_time_t: 1539647999
- extensions:
- authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
- subjectKeyIdentifier: 11:37:8F:56:DC:AF:E0:18:CB:07:A7:02:00:3C:DE:8C:B8:11:F4:3A
- keyUsage: Digital Signature, Key Encipherment
- basicConstraints: CA:FALSE
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
- crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
- authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
- subjectAltName: DNS:*.websitewelcome.com, DNS:websitewelcome.com
Number of occurences: 3
- Name:
Content: text/html; charset=windows-1252 - Name: GENERATOR
Content: Microsoft FrontPage 4.0 - Name: ProgId
Content: FrontPage.Editor.Document
Server / Hosting
- IP: 192.185.110.179
- Latitude: 29.83
- Longitude: -95.47
- Country: United States
- City: Houston
Rname
- ns1272.websitewelcome.com
- ns1271.websitewelcome.com
- thomasma.com
Target
- dnsadmin.boxer.websitewelcome.com
HTTP Header Response
HTTP/1.1 200 OK
Server: nginx/1.10.1
Date: Sun, 11 Sep 2016 23:43:35 GMT
Content-Type: text/html
Content-Length: 363
Last-Modified: Mon, 14 Jul 2008 17:22:53 GMT
Accept-Ranges: bytes
X-Cache: MISS from s_mf40
Via: 1.1 s_mf40 (squid/3.5.20)
Connection: keep-alive
DNS
host: thomasma.com
- class: IN
- ttl: 14400
- type: A
- ip: 192.185.110.179
host: thomasma.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1272.websitewelcome.com
host: thomasma.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1271.websitewelcome.com
host: thomasma.com
- class: IN
- ttl: 14400
- type: SOA
- mname: ns1271.websitewelcome.com
- rname: dnsadmin.boxer.websitewelcome.com
- serial: 2016013000
- refresh: 28800
- retry: 7200
- expire: 3600000
- minimum-ttl: 86400
host: thomasma.com
- class: IN
- ttl: 14400
- type: MX
- pri: 0
- target: thomasma.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.homasma.com, www.tqhomasma.com, www.qhomasma.com, www.tahomasma.com, www.ahomasma.com, www.t homasma.com, www. homasma.com, www.twhomasma.com, www.whomasma.com, www.tehomasma.com, www.ehomasma.com, www.tzhomasma.com, www.zhomasma.com, www.txhomasma.com, www.xhomasma.com, www.tchomasma.com, www.chomasma.com, www.tomasma.com, www.theomasma.com, www.teomasma.com, www.thdomasma.com, www.tdomasma.com, www.thcomasma.com, www.tcomasma.com, www.thuomasma.com, www.tuomasma.com, www.thjomasma.com, www.tjomasma.com, www.thomasma.com, www.tomasma.com, www.thbomasma.com, www.tbomasma.com, www.thgomasma.com, www.tgomasma.com, www.thmasma.com, www.thobmasma.com, www.thbmasma.com, www.thohmasma.com, www.thhmasma.com, www.thogmasma.com, www.thgmasma.com, www.thojmasma.com, www.thjmasma.com, www.thommasma.com, www.thmmasma.com, www.tho masma.com, www.th masma.com, www.thovmasma.com, www.thvmasma.com, www.thoasma.com, www.thompasma.com, www.thopasma.com, www.thomoasma.com, www.thooasma.com, www.thomiasma.com, www.thoiasma.com, www.thomkasma.com, www.thokasma.com, www.thom.asma.com, www.tho.asma.com, www.thomuasma.com, www.thouasma.com, www.thomjasma.com, www.thojasma.com, www.thomnasma.com, www.thonasma.com, www.thom-asma.com, www.tho-asma.com, www.thomsma.com, www.thomaosma.com, www.thomosma.com, www.thomapsma.com, www.thompsma.com, www.thoma9sma.com, www.thom9sma.com, www.thomasma.com, www.thomsma.com, www.thomaisma.com, www.thomisma.com, www.thomausma.com, www.thomusma.com, www.thomama.com, www.thomasema.com, www.thomaema.com, www.thomaswma.com, www.thomawma.com, www.thomasdma.com, www.thomadma.com, www.thomasxma.com, www.thomaxma.com, www.thomasfma.com, www.thomafma.com, www.thomasgma.com, www.thomagma.com, www.thomastma.com, www.thomatma.com, www.thomasa.com, www.thomasmpa.com, www.thomaspa.com, www.thomasmoa.com, www.thomasoa.com, www.thomasmia.com, www.thomasia.com, www.thomasmka.com, www.thomaska.com, www.thomasm.a.com, www.thomas.a.com, www.thomasmua.com, www.thomasua.com, www.thomasmja.com, www.thomasja.com, www.thomasmna.com, www.thomasna.com, www.thomasm-a.com, www.thomas-a.com, www.thomasm.com, www.thomasmao.com, www.thomasmo.com, www.thomasmap.com, www.thomasmp.com, www.thomasma9.com, www.thomasm9.com, www.thomasma.com, www.thomasm.com, www.thomasmai.com, www.thomasmi.com, www.thomasmau.com, www.thomasmu.com,
Other websites we recently analyzed
- 欢迎æ¥åˆ°Sentosa(圣淘沙)金èžç†è´¢å¹³å°
China - 103.248.220.105
Server software: Apache/2.4.10 (Win32) OpenSSL/0.9.8zb mod_fcgid/2.3.9
Technology: Html, Html5, Javascript, SVG
Number of meta tags: 1 - silverfork-app.com
Scottsdale (United States) - 184.168.221.56
Server software: squid/3.5.12
Technology: Html, Html5, Iframe - Serveur OVH
France - 176.31.233.232
Server software: Apache
Technology: Html - organicdoctor.tv
United Kingdom - 81.21.76.62
Server software: Apache/2.2.3 (CentOS)
Technology: CSS, Html, Javascript, Php
Number of Javascript: 1
Number of meta tags: 1 - Livingston Lures | Designed to call the fish to you!
The first and only fishing lure to feature an internal sound chamber that emits the sound of an injured baitfish upon contact with water.San Antonio (United States) - 23.253.64.63
Server software: Apache
Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, jQuery Cycle, jQuery Fancybox, jQuery Hover Intent, Php, Swf Object, Facebook Retargeting, Google Analytics, Drupal, Facebook Box, Twitter Button
Number of Javascript: 50
Number of meta tags: 8 - åˆå¹´æ¬¡æ•™è‚²å¦ä¼šï¼ˆJAFYE）
Tokyo (Japan) - 58.138.174.50
Server software:
Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 5
Number of meta tags: 3 - eliorsh.com
Scottsdale (United States) - 184.168.221.33
Server software: squid/3.5.12
Technology: Html, Html5, Iframe - Propaganda Kompany
Shop powered by PrestaShopFrance - 213.186.33.4
Server software: Apache
Technology: CSS, Html, Javascript, Php, Google Analytics, Prestashop
Number of Javascript: 11
Number of meta tags: 5 - Welcome to INSPIREDTRANSITION.COM
Scottsdale (United States) - 184.168.221.96
Server software: Microsoft-IIS/7.5
Technology: Google Adsense, CSS, Html, Javascript
Number of Javascript: 3
Number of meta tags: 1 - maidservicegivesladyperfectlife.com
United States - 66.151.177.21
Server software: nginx
Technology: DoubleClick.Net, CSS, Html, Javascript, Google Analytics
Number of Javascript: 7
Number of meta tags: 5